PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G482200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 728aa    MW: 82181.3 Da    PI: 7.4645
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G482200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA38.91.2e-122864135
                  GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C  Cg +   Tp++Rrgp+g +tLCnaCG+ ++k ++
  Sobic.001G482200.1.p 28 CLRCGISAnaTPHMRRGPEGRRTLCNACGIAWAKGKM 64
                          5567766667***********************9875 PP

2FAR1865.7e-2798183188
                  FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                           +fYn+YA +vGFsvrks+s ks +n  + +rt vCs+eg+r+++k + ++ +r+r+etr+gC a++++k ++dgk+++++++ +HnHe
  Sobic.001G482200.1.p  98 EFYNRYAGHVGFSVRKSSSDKSAENI-TRSRTCVCSREGFRKDKKGA-KEVKRPRPETRIGCPARMTIKITSDGKYRIAEFVADHNHE 183
                           6*********************6665.999*************9999.999************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.37E-92275No hitNo description
SMARTSM004015.7E-62277IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.6E-112765IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.9E-103062IPR000679Zinc finger, GATA-type
CDDcd002023.92E-63865No hitNo description
PfamPF031017.5E-2498183IPR004330FAR1 DNA binding domain
PfamPF105511.4E-25307401IPR018289MULE transposase domain
PfamPF044341.9E-5575619IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.94575622IPR007527Zinc finger, SWIM-type
SMARTSM005756.2E-4597624IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MQFDDDRDAG VGGGNGEVDD RVDEPARCLR CGISANATPH MRRGPEGRRT LCNACGIAWA  60
KGKMRKVIDS DTHIDDATVA KMVPEVGMEF DNEDKAYEFY NRYAGHVGFS VRKSSSDKSA  120
ENITRSRTCV CSREGFRKDK KGAKEVKRPR PETRIGCPAR MTIKITSDGK YRIAEFVADH  180
NHEPAPPSTM HMLRSQRVLT DLQTTEADSS EDSTTPSRIS SGCLVRQAGE TTNLNFLPAD  240
YRTSLPSKRM KNMQPGDAGA AVKYFQSMQM SSPSFFHAFQ LDEDDKLTNI FWADSKSRTD  300
FSYFGDVVCL DTTYKVNSHG RPLMLFLGVN HHKQISIFGA ALLYDESMES FKWLFDTFKV  360
ATGGKQPKTI LTDQSMTATA AITAAWPGTI HRHCPWQVYQ NAVKHLNHIF QGSKTFAKDL  420
SKCVYEYEEE EDFLLGWSTM LEKYDLRNNE WLRKLFQDRD KWAPVYNRHV FTADIKNSLQ  480
SESISSVLKK YLSPQFNLCS FFKHFEKVLD EHRYSELQAD FHASQSFPRI PPSKMLRQAA  540
SMYTPVVFEI FRREFEMSVD SVIYSCGEAG TASDYRVAVT DKPGEHYVKF ESSDFSAVCS  600
CKKFESMGIQ CCHVLKVLDF RNIKELPQKY FMGRWKKDAK SANTGNQEFL NDGASQTPSS  660
SLNGPGPFIH HQHMETNNQT NHDSSVSNLD QQGLHGDAQR NQGYTPVAGV QQLEFVGNFH  720
LNNGAGF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146150KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985481.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLC5WVS30.0C5WVS3_SORBI; Putative uncharacterized protein Sb01g045140
STRINGSb01g045140.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-117FAR1-related sequence 5